Lineage for d2xh4b2 (2xh4 B:141-436)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837305Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226794] (5 PDB entries)
  8. 2837319Domain d2xh4b2: 2xh4 B:141-436 [207242]
    Other proteins in same PDB: d2xh4a1, d2xh4a3, d2xh4b1, d2xh4b3, d2xh4c1, d2xh4c3, d2xh4d1, d2xh4d3
    automated match to d1pdza1
    complexed with 2pg, mg; mutant

Details for d2xh4b2

PDB Entry: 2xh4 (more details), 1.7 Å

PDB Description: engineering the enolase active site pocket: crystal structure of the s39a d321a mutant of yeast enolase 1
PDB Compounds: (B:) enolase 1

SCOPe Domain Sequences for d2xh4b2:

Sequence, based on SEQRES records: (download)

>d2xh4b2 c.1.11.0 (B:141-436) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tspyvlpvpflnvlnggshaggalalqefmiaptgaktfaealrigsevyhnlksltkkr
ygasagnvgdeggvapniqtaeealdlivdaikaaghdgkikigldcasseffkdgkydl
dfknpnsdkskwltgpqladlyhslmkrypivsiedpfaeddweawshffktagiqivad
altvtnpkriataiekkaadalllkvnqigtlsesikaaqdsfaagwgvmvshrsgeted
tfiadlvvglrtgqiktgaparserlaklnqllrieeelgdnavfagenfhhgdkl

Sequence, based on observed residues (ATOM records): (download)

>d2xh4b2 c.1.11.0 (B:141-436) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tspyvlpvpflnvlnggshaggalalqefmiaptgaktfaealrigsevyhnlksltkkr
ygasagnvgdeggvapniqtaeealdlivdaikaaghdgkikigldcasseffkdgkydl
dfknnsdkskwltgpqladlyhslmkrypivsiedpfaeddweawshffktagiqivada
ltvtnpkriataiekkaadalllkvnqigtlsesikaaqdsfaagwgvmvshrsgetedt
fiadlvvglrtgqiktgaparserlaklnqllrieeelgdnavfagenfhhgdkl

SCOPe Domain Coordinates for d2xh4b2:

Click to download the PDB-style file with coordinates for d2xh4b2.
(The format of our PDB-style files is described here.)

Timeline for d2xh4b2: