Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (83 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225955] (5 PDB entries) |
Domain d2xh4b1: 2xh4 B:1-140 [207241] Other proteins in same PDB: d2xh4a2, d2xh4b2, d2xh4c2, d2xh4d2 automated match to d1pdza2 complexed with 2pg, mg; mutant |
PDB Entry: 2xh4 (more details), 1.7 Å
SCOPe Domain Sequences for d2xh4b1:
Sequence, based on SEQRES records: (download)
>d2xh4b1 d.54.1.0 (B:1-140) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} avskvyarsvydsrgnptvevelttekgvfrsivpsgaatgvhealemrdgdkskwmgkg vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra aaaeknvplykhladlsksk
>d2xh4b1 d.54.1.0 (B:1-140) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} avskvyarsvydsrgnptvevelttekgvfrsivpsggvlhavknvndviapafvkanid vkdqkavddflisldgtanksklganailgvslaasraaaaeknvplykhladlsksk
Timeline for d2xh4b1: