Lineage for d1qsfa1 (1qsf A:182-274)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654537Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 654538Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries)
  8. 654708Domain d1qsfa1: 1qsf A:182-274 [20724]
    Other proteins in same PDB: d1qsfa2, d1qsfb_, d1qsfd1, d1qsfd2, d1qsfe1, d1qsfe2

Details for d1qsfa1

PDB Entry: 1qsf (more details), 2.8 Å

PDB Description: structure of a6-tcr bound to hla-a2 complexed with altered htlv-1 tax peptide y8a
PDB Compounds: (A:) MHC class I hla-a

SCOP Domain Sequences for d1qsfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsfa1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqadgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrw

SCOP Domain Coordinates for d1qsfa1:

Click to download the PDB-style file with coordinates for d1qsfa1.
(The format of our PDB-style files is described here.)

Timeline for d1qsfa1: