Lineage for d2xh2a1 (2xh2 A:1-140)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2947972Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225955] (5 PDB entries)
  8. 2947973Domain d2xh2a1: 2xh2 A:1-140 [207231]
    Other proteins in same PDB: d2xh2a2, d2xh2a3, d2xh2b2, d2xh2b3, d2xh2c2, d2xh2c3, d2xh2d2, d2xh2d3
    automated match to d1pdza2
    complexed with 2pg, mg; mutant

Details for d2xh2a1

PDB Entry: 2xh2 (more details), 1.8 Å

PDB Description: engineering the enolase active site pocket: crystal structure of the s39n d321a mutant of yeast enolase 1
PDB Compounds: (A:) enolase 1

SCOPe Domain Sequences for d2xh2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xh2a1 d.54.1.0 (A:1-140) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
avskvyarsvydsrgnptvevelttekgvfrsivpsgantgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlsksk

SCOPe Domain Coordinates for d2xh2a1:

Click to download the PDB-style file with coordinates for d2xh2a1.
(The format of our PDB-style files is described here.)

Timeline for d2xh2a1: