Lineage for d2xgza2 (2xgz A:141-436)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837305Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226794] (5 PDB entries)
  8. 2837314Domain d2xgza2: 2xgz A:141-436 [207220]
    Other proteins in same PDB: d2xgza1, d2xgza3, d2xgzb1, d2xgzb3
    automated match to d1pdza1
    complexed with mg, pep; mutant

Details for d2xgza2

PDB Entry: 2xgz (more details), 1.8 Å

PDB Description: engineering the enolase active site pocket: crystal structure of the s39n d321r mutant of yeast enolase 1
PDB Compounds: (A:) enolase 1

SCOPe Domain Sequences for d2xgza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xgza2 c.1.11.0 (A:141-436) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tspyvlpvpflnvlnggshaggalalqefmiaptgaktfaealrigsevyhnlksltkkr
ygasagnvgdeggvapniqtaeealdlivdaikaaghdgkikigldcasseffkdgkydl
dfknpnsdkskwltgpqladlyhslmkrypivsiedpfaeddweawshffktagiqivad
rltvtnpkriataiekkaadalllkvnqigtlsesikaaqdsfaagwgvmvshrsgeted
tfiadlvvglrtgqiktgaparserlaklnqllrieeelgdnavfagenfhhgdkl

SCOPe Domain Coordinates for d2xgza2:

Click to download the PDB-style file with coordinates for d2xgza2.
(The format of our PDB-style files is described here.)

Timeline for d2xgza2: