| Class b: All beta proteins [48724] (111 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
| Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species) |
| Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [48948] (29 PDB entries) |
| Domain d1qsea1: 1qse A:182-274 [20722] Other proteins in same PDB: d1qsea2, d1qsed1, d1qsed2, d1qsee1, d1qsee2 |
PDB Entry: 1qse (more details), 2.8 Å
SCOP Domain Sequences for d1qsea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qsea1 b.1.1.2 (A:182-274) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2.1}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrw
Timeline for d1qsea1: