Lineage for d1qsea1 (1qse A:182-274)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2746844Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2746845Species Human (Homo sapiens) [TaxId:9606] [88605] (203 PDB entries)
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 2747112Domain d1qsea1: 1qse A:182-274 [20722]
    Other proteins in same PDB: d1qsea2, d1qseb_, d1qsed1, d1qsed2, d1qsee1, d1qsee2

Details for d1qsea1

PDB Entry: 1qse (more details), 2.8 Å

PDB Description: structure of human a6-tcr bound to hla-a2 complexed with altered htlv- 1 tax peptide v7r
PDB Compounds: (A:) PROTEIN (MHC class I HLA-A)

SCOPe Domain Sequences for d1qsea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsea1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrw

SCOPe Domain Coordinates for d1qsea1:

Click to download the PDB-style file with coordinates for d1qsea1.
(The format of our PDB-style files is described here.)

Timeline for d1qsea1: