![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
![]() | Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) ![]() |
![]() | Family a.73.1.0: automated matches [227254] (1 protein) not a true family |
![]() | Protein automated matches [227039] (3 species) not a true protein |
![]() | Species Microcebus murinus [TaxId:30608] [225978] (1 PDB entry) |
![]() | Domain d2xgva_: 2xgv A: [207218] automated match to d2pwob_ |
PDB Entry: 2xgv (more details), 2 Å
SCOPe Domain Sequences for d2xgva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xgva_ a.73.1.0 (A:) automated matches {Microcebus murinus [TaxId: 30608]} pvvnrgqgwayepmstrtvaawirqtgekgltspetitywglisqdlssreqvqllevvp glqadkdmlgayleerarewdaqpqqplpytsahirgltgdqafaisaqgreaaqvfraw itqglmnlaqlra
Timeline for d2xgva_: