Lineage for d2xgva_ (2xgv A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717816Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2717817Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2718058Family a.73.1.0: automated matches [227254] (1 protein)
    not a true family
  6. 2718059Protein automated matches [227039] (3 species)
    not a true protein
  7. 2718071Species Microcebus murinus [TaxId:30608] [225978] (1 PDB entry)
  8. 2718072Domain d2xgva_: 2xgv A: [207218]
    automated match to d2pwob_

Details for d2xgva_

PDB Entry: 2xgv (more details), 2 Å

PDB Description: structure of the n-terminal domain of capsid protein from rabbit endogenous lentivirus (relik)
PDB Compounds: (A:) psiv capsid n-terminal domain

SCOPe Domain Sequences for d2xgva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xgva_ a.73.1.0 (A:) automated matches {Microcebus murinus [TaxId: 30608]}
pvvnrgqgwayepmstrtvaawirqtgekgltspetitywglisqdlssreqvqllevvp
glqadkdmlgayleerarewdaqpqqplpytsahirgltgdqafaisaqgreaaqvfraw
itqglmnlaqlra

SCOPe Domain Coordinates for d2xgva_:

Click to download the PDB-style file with coordinates for d2xgva_.
(The format of our PDB-style files is described here.)

Timeline for d2xgva_: