Lineage for d2xg5b_ (2xg5 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377239Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2377244Family b.2.3.2: Pilus subunits [49405] (10 proteins)
  6. 2377405Protein PAP fimbrial minor pilin protein PapH [158924] (1 species)
  7. 2377406Species Escherichia coli [TaxId:562] [158925] (3 PDB entries)
    Uniprot P07111 46-195
  8. 2377407Domain d2xg5b_: 2xg5 B: [207215]
    Other proteins in same PDB: d2xg5a1, d2xg5a2
    automated match to d2j2zb1
    complexed with co, ec2, ec5, gol, pgo

Details for d2xg5b_

PDB Entry: 2xg5 (more details), 2 Å

PDB Description: e. coli p pilus chaperone-subunit complex papd-paph bound to pilus biogenesis inhibitor, pilicide 5d
PDB Compounds: (B:) pap fimbrial minor pilin protein

SCOPe Domain Sequences for d2xg5b_:

Sequence, based on SEQRES records: (download)

>d2xg5b_ b.2.3.2 (B:) PAP fimbrial minor pilin protein PapH {Escherichia coli [TaxId: 562]}
aafhgevvrpactlamedawqiidmgetpvrdlqngfsgperkfslrlrncefnsqggnl
fsdsrirvtfdgvrgetpdkfnlsgqakginlqiadvrgniaragkvmpaipltgneeal
dytlrivrngkkleagnyfavlgfrvdye

Sequence, based on observed residues (ATOM records): (download)

>d2xg5b_ b.2.3.2 (B:) PAP fimbrial minor pilin protein PapH {Escherichia coli [TaxId: 562]}
aafhgevvrpactlamedawqiidmgetpvrdlqngfsgperkfslrlrncefnsqggnl
fsdsrirvtfdgvrgetpdkfnlsgqakginlqiadvrgniaragkvmpaiplteealdy
tlrivrngkkleagnyfavlgfrvdye

SCOPe Domain Coordinates for d2xg5b_:

Click to download the PDB-style file with coordinates for d2xg5b_.
(The format of our PDB-style files is described here.)

Timeline for d2xg5b_: