Class b: All beta proteins [48724] (174 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) |
Family b.2.3.2: Pilus subunits [49405] (9 proteins) |
Protein PAP fimbrial minor pilin protein PapH [158924] (1 species) |
Species Escherichia coli [TaxId:562] [158925] (3 PDB entries) Uniprot P07111 46-195 |
Domain d2xg5b_: 2xg5 B: [207215] Other proteins in same PDB: d2xg5a1, d2xg5a2 automated match to d2j2zb1 complexed with co, ec2, ec5, gol, pgo |
PDB Entry: 2xg5 (more details), 2 Å
SCOPe Domain Sequences for d2xg5b_:
Sequence, based on SEQRES records: (download)
>d2xg5b_ b.2.3.2 (B:) PAP fimbrial minor pilin protein PapH {Escherichia coli [TaxId: 562]} aafhgevvrpactlamedawqiidmgetpvrdlqngfsgperkfslrlrncefnsqggnl fsdsrirvtfdgvrgetpdkfnlsgqakginlqiadvrgniaragkvmpaipltgneeal dytlrivrngkkleagnyfavlgfrvdye
>d2xg5b_ b.2.3.2 (B:) PAP fimbrial minor pilin protein PapH {Escherichia coli [TaxId: 562]} aafhgevvrpactlamedawqiidmgetpvrdlqngfsgperkfslrlrncefnsqggnl fsdsrirvtfdgvrgetpdkfnlsgqakginlqiadvrgniaragkvmpaiplteealdy tlrivrngkkleagnyfavlgfrvdye
Timeline for d2xg5b_: