SCOPe 2.08: Domain d2xg5a1: 2xg5 A:1-124

Lineage for d2xg5a1 (2xg5 A:1-124)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (3 families)
   contains PP switch between strands D and C'

5. Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
   automatically mapped to Pfam PF00345

6. Protein Pilus chaperone PapD, N-domain [49356] (1 species)
   consists of two domains of this fold; domain 2 has an additional strand at the C-terminus

7. Species Escherichia coli [TaxId:562] [49357] (15 PDB entries)

8. Domain d2xg5a1: 2xg5 A:1-124 [207213]
   Other proteins in same PDB: d2xg5a2, d2xg5b_
   automated match to d1pdka1
   complexed with co, ec2, ec5, gol, pgo

Details for d2xg5a1

PDB Entry: 2xg5, 2 Å

PDB Description: e. coli p pilus chaperone-subunit complex papd-paph bound to pilus biogenesis inhibitor, pilicide 5d

PDB Compounds: (A:) chaperone protein papd

SCOPe Domain Sequences for d2xg5a1:

Sequence; same for both SEQRES and ATOM records:

>d2xg5a1 b.1.11.1 (A:1-124) Pilus chaperone PapD, N-domain {Escherichia coli [TaxId: 562]}
avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrle
pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai
ktrp

Timeline for d2xg5a1:

• d2xg5a1 first appeared in SCOPe 2.03
  
• d2xg5a1 appears in SCOPe 2.07