![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
![]() | Family b.2.3.2: Pilus subunits [49405] (11 proteins) |
![]() | Protein PAP fimbrial minor pilin protein PapH [158924] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [158925] (3 PDB entries) Uniprot P07111 46-195 |
![]() | Domain d2xg4b_: 2xg4 B: [207212] Other proteins in same PDB: d2xg4a1, d2xg4a2 automated match to d2j2zb1 complexed with co, gol, xc2 |
PDB Entry: 2xg4 (more details), 2.4 Å
SCOPe Domain Sequences for d2xg4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xg4b_ b.2.3.2 (B:) PAP fimbrial minor pilin protein PapH {Escherichia coli [TaxId: 562]} aafhgevvrpactlamedawqiidmgetpvrdlqngfsgperkfslrlrncefnsqggnl fsdsrirvtfdgvrgetpdkfnlsgqakginlqiadvrgniaragkvmpaipltgneeal dytlrivrngkkleagnyfavlgfrvdye
Timeline for d2xg4b_: