Lineage for d2xg4b_ (2xg4 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767443Family b.2.3.2: Pilus subunits [49405] (11 proteins)
  6. 2767638Protein PAP fimbrial minor pilin protein PapH [158924] (1 species)
  7. 2767639Species Escherichia coli [TaxId:562] [158925] (3 PDB entries)
    Uniprot P07111 46-195
  8. 2767641Domain d2xg4b_: 2xg4 B: [207212]
    Other proteins in same PDB: d2xg4a1, d2xg4a2
    automated match to d2j2zb1
    complexed with co, gol, xc2

Details for d2xg4b_

PDB Entry: 2xg4 (more details), 2.4 Å

PDB Description: e. coli p pilus chaperone-subunit complex papd-paph bound to pilus biogenesis inhibitor, pilicide 2c
PDB Compounds: (B:) pap fimbrial minor pilin protein

SCOPe Domain Sequences for d2xg4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xg4b_ b.2.3.2 (B:) PAP fimbrial minor pilin protein PapH {Escherichia coli [TaxId: 562]}
aafhgevvrpactlamedawqiidmgetpvrdlqngfsgperkfslrlrncefnsqggnl
fsdsrirvtfdgvrgetpdkfnlsgqakginlqiadvrgniaragkvmpaipltgneeal
dytlrivrngkkleagnyfavlgfrvdye

SCOPe Domain Coordinates for d2xg4b_:

Click to download the PDB-style file with coordinates for d2xg4b_.
(The format of our PDB-style files is described here.)

Timeline for d2xg4b_: