Lineage for d2xg4a2 (2xg4 A:125-217)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1775883Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1776151Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) (S)
  5. 1776152Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)
  6. 1776203Protein PapD [49586] (1 species)
  7. 1776204Species Escherichia coli [TaxId:562] [49587] (14 PDB entries)
  8. 1776207Domain d2xg4a2: 2xg4 A:125-217 [207211]
    Other proteins in same PDB: d2xg4a1, d2xg4b_
    automated match to d1pdka2
    complexed with co, gol, xc2

Details for d2xg4a2

PDB Entry: 2xg4 (more details), 2.4 Å

PDB Description: e. coli p pilus chaperone-subunit complex papd-paph bound to pilus biogenesis inhibitor, pilicide 2c
PDB Compounds: (A:) chaperone protein papd

SCOPe Domain Sequences for d2xg4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xg4a2 b.7.2.1 (A:125-217) PapD {Escherichia coli [TaxId: 562]}
nevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqtvksa
nyntpylsyindyggrpvlsficngsrcsvkke

SCOPe Domain Coordinates for d2xg4a2:

Click to download the PDB-style file with coordinates for d2xg4a2.
(The format of our PDB-style files is described here.)

Timeline for d2xg4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2xg4a1
View in 3D
Domains from other chains:
(mouse over for more information)
d2xg4b_