Lineage for d2xg4a1 (2xg4 A:1-124)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2374559Superfamily b.1.11: PapD-like [49354] (3 families) (S)
    contains PP switch between strands D and C'
  5. 2374560Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
    automatically mapped to Pfam PF00345
  6. 2374621Protein Pilus chaperone PapD, N-domain [49356] (1 species)
    consists of two domains of this fold; domain 2 has an additional strand at the C-terminus
  7. 2374622Species Escherichia coli [TaxId:562] [49357] (15 PDB entries)
  8. 2374625Domain d2xg4a1: 2xg4 A:1-124 [207210]
    Other proteins in same PDB: d2xg4a2, d2xg4b_
    automated match to d1pdka1
    complexed with co, gol, xc2

Details for d2xg4a1

PDB Entry: 2xg4 (more details), 2.4 Å

PDB Description: e. coli p pilus chaperone-subunit complex papd-paph bound to pilus biogenesis inhibitor, pilicide 2c
PDB Compounds: (A:) chaperone protein papd

SCOPe Domain Sequences for d2xg4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xg4a1 b.1.11.1 (A:1-124) Pilus chaperone PapD, N-domain {Escherichia coli [TaxId: 562]}
avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrle
pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai
ktrp

SCOPe Domain Coordinates for d2xg4a1:

Click to download the PDB-style file with coordinates for d2xg4a1.
(The format of our PDB-style files is described here.)

Timeline for d2xg4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2xg4a2
View in 3D
Domains from other chains:
(mouse over for more information)
d2xg4b_