| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) ![]() N-terminal domain is beta/beta/alpha common fold |
| Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins) |
| Protein Monoamine oxidase B [69673] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [69674] (46 PDB entries) |
| Domain d2xfqb2: 2xfq B:290-401 [207205] Other proteins in same PDB: d2xfqa1, d2xfqb1 automated match to d1s3ea2 complexed with c15, fad, ras, xcg |
PDB Entry: 2xfq (more details), 2.2 Å
SCOPe Domain Sequences for d2xfqb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xfqb2 d.16.1.5 (B:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka
rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty
Timeline for d2xfqb2: