SCOPe 2.02: Domain d1b0ra1: 1b0r A:182-275

Lineage for d1b0ra1 (1b0r A:182-275)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (157 PDB entries)
   Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor

8. Domain d1b0ra1: 1b0r A:182-275 [20720]
   Other proteins in same PDB: d1b0ra2, d1b0rb_

Details for d1b0ra1

PDB Entry: 1b0r, 2.9 Å

PDB Description: crystal structure of hla-a*0201 complexed with a peptide with the carboxyl-terminal group substituted by a methyl group

PDB Compounds: (A:) protein (hla-a*0201)

SCOPe Domain Sequences for d1b0ra1:

Sequence, based on SEQRES records:

>d1b0ra1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Sequence, based on observed residues (ATOM records):

>d1b0ra1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrqdtelvetrpagdgtfqkwaav
vvpsgqeqrytchvqheglpkpltlrwe

Timeline for d1b0ra1:

• d1b0ra1 first appeared (with stable ids) in SCOP 1.55
  
• d1b0ra1 appears in SCOPe 2.01
  
• d1b0ra1 appears in SCOPe 2.03
  
• d1b0ra1 appears in the current release, SCOPe 2.08