SCOP 1.65: Domain d1b0ra1: 1b0r A:182-275

Lineage for d1b0ra1 (1b0r A:182-275)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (56 PDB entries)

8. Domain d1b0ra1: 1b0r A:182-275 [20720]
   Other proteins in same PDB: d1b0ra2, d1b0rb_
   complexed with cde; mutant

Details for d1b0ra1

PDB Entry: 1b0r, 2.9 Å

PDB Description: crystal structure of hla-a*0201 complexed with a peptide with the carboxyl-terminal group substituted by a methyl group

SCOP Domain Sequences for d1b0ra1:

Sequence, based on SEQRES records:

>d1b0ra1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Sequence, based on observed residues (ATOM records):

>d1b0ra1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrqdtelvetrpagdgtfqkwaav
vvpsgqeqrytchvqheglpkpltlrwe

Timeline for d1b0ra1:

• d1b0ra1 first appeared (with stable ids) in SCOP 1.55
  
• d1b0ra1 appears in SCOP 1.63
  
• d1b0ra1 appears in SCOP 1.67
  
• d1b0ra1 appears in the current release, SCOPe 2.08