Lineage for d1b0ra1 (1b0r A:182-275)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 158811Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)
  7. 158828Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [48948] (29 PDB entries)
  8. 158904Domain d1b0ra1: 1b0r A:182-275 [20720]
    Other proteins in same PDB: d1b0ra2

Details for d1b0ra1

PDB Entry: 1b0r (more details), 2.9 Å

PDB Description: crystal structure of hla-a*0201 complexed with a peptide with the carboxyl-terminal group substituted by a methyl group

SCOP Domain Sequences for d1b0ra1:

Sequence, based on SEQRES records: (download)

>d1b0ra1 b.1.1.2 (A:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2.1}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Sequence, based on observed residues (ATOM records): (download)

>d1b0ra1 b.1.1.2 (A:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2.1}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrqdtelvetrpagdgtfqkwaav
vvpsgqeqrytchvqheglpkpltlrwe

SCOP Domain Coordinates for d1b0ra1:

Click to download the PDB-style file with coordinates for d1b0ra1.
(The format of our PDB-style files is described here.)

Timeline for d1b0ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b0ra2
View in 3D
Domains from other chains:
(mouse over for more information)
d1b0rb1