![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Saccharopolyspora erythraea [TaxId:1836] [225746] (6 PDB entries) |
![]() | Domain d2xfha_: 2xfh A: [207193] automated match to d1z8oa_ complexed with cl6, dms, hem |
PDB Entry: 2xfh (more details), 1.9 Å
SCOPe Domain Sequences for d2xfha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xfha_ a.104.1.0 (A:) automated matches {Saccharopolyspora erythraea [TaxId: 1836]} idevpgmadetalldwlgtmrekqpvwqdrygvwhvfrhadvqtvlrdtatfssdptrvi egasptpgmiheidppehralrkvvssaftprtisdleprirdvtrslladagesfdlvd vlafplpvtivaellglppmdheqfgdwsgalvdiqmddptdpalaeriadvlnpltayl karcaerradpgddlisrlvlaevdgralddeeaanfstalllaghitttvllgnivrtl dehpahwdaaaedpgripaiveevlryrppfpqmqrtttkatevagvpipadvmvntwvl sanrdsdahddpdrfdpsrksggaaqlsfghgvhfclgaplarlenrvaleeiiarfgrl tvdrdderlrhfeqivlgtrhlpvlagssprqsa
Timeline for d2xfha_: