![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) ![]() |
![]() | Family d.109.1.0: automated matches [191561] (1 protein) not a true family |
![]() | Protein automated matches [190971] (11 species) not a true protein |
![]() | Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [226159] (1 PDB entry) |
![]() | Domain d2xf1a_: 2xf1 A: [207192] automated match to d1f7sa_ complexed with so4 |
PDB Entry: 2xf1 (more details), 1.96 Å
SCOPe Domain Sequences for d2xf1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xf1a_ d.109.1.0 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} gsmisgirvndncvtefnnmkirktcgwiifviqnceiiihskgasttltelvqsidknn eiqcayvvfdavskihffmyaressnsrdrmtyasskqailkkiegvnvltsviesaqdv ad
Timeline for d2xf1a_: