SCOPe 2.07: Domain d2xdwa2: 2xdw A:431-710

Lineage for d2xdwa2 (2xdw A:431-710)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.4: Prolyl oligopeptidase, C-terminal domain [53496] (2 proteins)
   N-terminal domain is a 7-bladed beta-propeller
   automatically mapped to Pfam PF00326

6. Protein Prolyl oligopeptidase, C-terminal domain [53497] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [53498] (27 PDB entries)
   Uniprot P23687

8. Domain d2xdwa2: 2xdw A:431-710 [207191]
   Other proteins in same PDB: d2xdwa1
   automated match to d1qfma2
   complexed with gol, tam

Details for d2xdwa2

PDB Entry: 2xdw, 1.35 Å

PDB Description: inhibition of prolyl oligopeptidase with a synthetic unnatural dipeptide

PDB Compounds: (A:) prolyl endopeptidase

SCOPe Domain Sequences for d2xdwa2:

Sequence; same for both SEQRES and ATOM records:

>d2xdwa2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
dasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygyggfnisitpnysvsrli
fvrhmggvlavanirgggeygetwhkggilankqncfddfqcaaeylikegytspkrlti
nggsnggllvatcanqrpdlfgcviaqvgvmdmlkfhkytighawttdygcsdskqhfew
likysplhnvklpeaddiqypsmllltadhddrvvplhslkfiatlqyivgrsrkqnnpl
lihvdtkaghgagkptakvieevsdmfafiarclnidwip

Timeline for d2xdwa2:

• d2xdwa2 first appeared in SCOPe 2.03
  
• d2xdwa2 appears in SCOPe 2.06
  
• d2xdwa2 appears in the current release, SCOPe 2.08