Lineage for d2xdwa1 (2xdw A:1-430)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2399102Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2399593Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families) (S)
  5. 2399594Family b.69.7.1: Prolyl oligopeptidase, N-terminal domain [50994] (2 protein domains)
    automatically mapped to Pfam PF02897
  6. 2399595Protein Prolyl oligopeptidase, N-terminal domain [50995] (2 species)
  7. 2399598Species Pig (Sus scrofa) [TaxId:9823] [50996] (27 PDB entries)
    Uniprot P23687
  8. 2399609Domain d2xdwa1: 2xdw A:1-430 [207190]
    Other proteins in same PDB: d2xdwa2
    automated match to d1qfma1
    complexed with gol, tam

Details for d2xdwa1

PDB Entry: 2xdw (more details), 1.35 Å

PDB Description: inhibition of prolyl oligopeptidase with a synthetic unnatural dipeptide
PDB Compounds: (A:) prolyl endopeptidase

SCOPe Domain Sequences for d2xdwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xdwa1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mlsfqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpir
glykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnils
ddgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawth
dgkgmfynaypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggael
sddgryvllsiregcdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvf
tfktnrhspnyrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvknt
lqlhdlatgallkifplevgsvvgysgqkkdteifyqftsflspgiiyhcdltkeelepr
vfrevtvkgi

SCOPe Domain Coordinates for d2xdwa1:

Click to download the PDB-style file with coordinates for d2xdwa1.
(The format of our PDB-style files is described here.)

Timeline for d2xdwa1: