SCOPe 2.08: Domain d2xdpa2: 2xdp A:936-994

Lineage for d2xdpa2 (2xdp A:936-994)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.0: automated matches [191625] (1 protein)
   not a true family

6. Protein automated matches [191144] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189286] (22 PDB entries)

8. Domain d2xdpa2: 2xdp A:936-994 [207184]
   automated match to d2qqra2
   complexed with so4

Details for d2xdpa2

PDB Entry: 2xdp, 1.56 Å

PDB Description: crystal structure of the tudor domain of human jmjd2c

PDB Compounds: (A:) lysine-specific demethylase 4c

SCOPe Domain Sequences for d2xdpa2:

Sequence; same for both SEQRES and ATOM records:

>d2xdpa2 b.34.9.0 (A:936-994) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppaegevvqvkwpdgklygakyfgsniahmyqvefedgsqiamkrediytldeelpkrv

Timeline for d2xdpa2:

• d2xdpa2 first appeared in SCOPe 2.03
  
• d2xdpa2 appears in SCOPe 2.07