Lineage for d2xbka_ (2xbk A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1277465Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1277466Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1278000Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1278001Protein automated matches [190847] (33 species)
    not a true protein
  7. 1278273Species Streptomyces natalensis [TaxId:68242] [225950] (2 PDB entries)
  8. 1278274Domain d2xbka_: 2xbk A: [207174]
    automated match to d2nzaa_
    complexed with hem, xbk

Details for d2xbka_

PDB Entry: 2xbk (more details), 1.95 Å

PDB Description: x-ray structure of the substrate-bound cytochrome p450 pimd - a polyene macrolide antibiotic pimaricin epoxidase
PDB Compounds: (A:) pimd protein

SCOPe Domain Sequences for d2xbka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xbka_ a.104.1.0 (A:) automated matches {Streptomyces natalensis [TaxId: 68242]}
dlpclnleppkmlklspllralqdrgpihrvrtpagdeawlvtrhaelkqllhderigrt
hpdppsaaqyvrspfldllisdadaesgrrqhaetrrlltplfsarrvlemqpkveeaad
tlldafiaqgppgdlhgeltvpfaltvlcevigvppqrraelttllagiaklddregavr
aqddlfgyvaglvehkraepgpdiisrlndgeltedrvahlamgllfagldsvasimdng
vvllaahpdqraaaladpdvmaraveevlrtaraggsvlppryasedmefggvtiragdl
vlfdlglpnfderaftgpeefdaartpnphltfghgiwhcigaplarlelrtmftklftr
lpelrpelpveqlrlkegqlsggfaelrvvw

SCOPe Domain Coordinates for d2xbka_:

Click to download the PDB-style file with coordinates for d2xbka_.
(The format of our PDB-style files is described here.)

Timeline for d2xbka_: