SCOPe 2.05: Domain d2xb5a2: 2xb5 A:68-208

Lineage for d2xb5a2 (2xb5 A:68-208)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species)

7. Species Escherichia coli [TaxId:562] [48501] (23 PDB entries)

8. Domain d2xb5a2: 2xb5 A:68-208 [207171]
   Other proteins in same PDB: d2xb5a1
   automated match to d2tcta2
   complexed with cl, i7t, mg

Details for d2xb5a2

PDB Entry: 2xb5, 2.5 Å

PDB Description: tet repressor (class d) in complex with 7-iodotetracycline

PDB Compounds: (A:) tetracycline repressor protein class d

SCOPe Domain Sequences for d2xb5a2:

Sequence; same for both SEQRES and ATOM records:

>d2xb5a2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

Timeline for d2xb5a2:

• d2xb5a2 first appeared in SCOPe 2.03
  
• d2xb5a2 appears in SCOPe 2.04
  
• d2xb5a2 appears in SCOPe 2.06
  
• d2xb5a2 appears in the current release, SCOPe 2.08