| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) ![]() |
| Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
| Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species) |
| Species Escherichia coli [TaxId:562] [48501] (37 PDB entries) |
| Domain d2xb5a2: 2xb5 A:68-208 [207171] Other proteins in same PDB: d2xb5a1 automated match to d2tcta2 complexed with cl, i7t, mg |
PDB Entry: 2xb5 (more details), 2.5 Å
SCOPe Domain Sequences for d2xb5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xb5a2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv
Timeline for d2xb5a2: