SCOPe 2.08: Domain d2xb5a1: 2xb5 A:2-67

Lineage for d2xb5a1 (2xb5 A:2-67)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)

7. Species Escherichia coli [TaxId:562] [46766] (36 PDB entries)

8. Domain d2xb5a1: 2xb5 A:2-67 [207170]
   Other proteins in same PDB: d2xb5a2
   automated match to d2tcta1
   complexed with cl, i7t, mg

Details for d2xb5a1

PDB Entry: 2xb5, 2.5 Å

PDB Description: tet repressor (class d) in complex with 7-iodotetracycline

PDB Compounds: (A:) tetracycline repressor protein class d

SCOPe Domain Sequences for d2xb5a1:

Sequence; same for both SEQRES and ATOM records:

>d2xb5a1 a.4.1.9 (A:2-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
arlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
rhhdys

Timeline for d2xb5a1:

• d2xb5a1 first appeared in SCOPe 2.03
  
• d2xb5a1 appears in SCOPe 2.07