Lineage for d2x9pa_ (2x9p A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005911Species Streptomyces natalensis [TaxId:68242] [225950] (2 PDB entries)
  8. 2005913Domain d2x9pa_: 2x9p A: [207163]
    automated match to d2nzaa_
    complexed with hem, so4

Details for d2x9pa_

PDB Entry: 2x9p (more details), 2.1 Å

PDB Description: x-ray structure of the substrate-free cytochrome p450 pimd -a polyene macrolide antibiotic pimaricin epoxidase
PDB Compounds: (A:) pimd protein

SCOPe Domain Sequences for d2x9pa_:

Sequence, based on SEQRES records: (download)

>d2x9pa_ a.104.1.0 (A:) automated matches {Streptomyces natalensis [TaxId: 68242]}
shdlpclnleppkmlklspllralqdrgpihrvrtpagdeawlvtrhaelkqllhderig
rthpdppsaaqyvrspfldllisdadaesgrrqhaetrrlltplfsarrvlemqpkveea
adtlldafiaqgppgdlhgeltvpfaltvlcevigvppqrraelttllagiaklddrega
vraqddlfgyvaglvehkraepgpdiisrlndgeltedrvahlamgllfagldsvasimd
ngvvllaahpdqraaaladpdvmaraveevlrtaraggsvlppryasedmefggvtirag
dlvlfdlglpnfderaftgpeefdaartpnphltfghgiwhcigaplarlelrtmftklf
trlpelrpelpveqlrlkegqlsggfaelrvvw

Sequence, based on observed residues (ATOM records): (download)

>d2x9pa_ a.104.1.0 (A:) automated matches {Streptomyces natalensis [TaxId: 68242]}
shdlpclnleppkmlklspllralqdrgpihrvrtpagdeawlvtrhaelkqllhderig
rthpdppsaaqyvrspfldllisdadaesgrrqhaetrrlltplfsarrvlemqpkveea
adtlldafiaqgppgdlhgeltvpfaltvlcevigvppqrraelttllagiaklddrega
vraqddlfgyvaglvehkraepgpdiisrlndgeltedrvahlamgllfagldsvasimd
ngvvllaahpdqraaaladpdvmaraveevlrtaraggsvlppryasedmefggvtirag
dlvlfdlglpnfderaftgpeefdaartpnphltfghgiwhcigaplarlelrtmftklf
trlpelrpelpveqlrlfaelrvvw

SCOPe Domain Coordinates for d2x9pa_:

Click to download the PDB-style file with coordinates for d2x9pa_.
(The format of our PDB-style files is described here.)

Timeline for d2x9pa_: