SCOPe 2.08: Domain d2x9ha2: 2x9h A:25-68

Lineage for d2x9ha2 (2x9h A:25-68)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families)

5. Family b.34.3.0: automated matches [227148] (1 protein)
   not a true family

6. Protein automated matches [226852] (4 species)
   not a true protein

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [226128] (1 PDB entry)

8. Domain d2x9ha2: 2x9h A:25-68 [207158]
   Other proteins in same PDB: d2x9ha1
   automated match to d1jwya1
   complexed with ad9, ki9, mg

Details for d2x9ha2

PDB Entry: 2x9h, 2.7 Å

PDB Description: crystal structure of myosin-2 motor domain in complex with adp-metavanadate and pentachlorocarbazole

PDB Compounds: (A:) myosin-2 heavy chain

SCOPe Domain Sequences for d2x9ha2:

Sequence; same for both SEQRES and ATOM records:

>d2x9ha2 b.34.3.0 (A:25-68) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
fkltvsdkryiwynpdpkerdsyecgeivsetsdsftfktvdgq

Timeline for d2x9ha2:

• d2x9ha2 first appeared in SCOPe 2.03
  
• d2x9ha2 appears in SCOPe 2.07