![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) ![]() |
![]() | Family b.34.3.0: automated matches [227148] (1 protein) not a true family |
![]() | Protein automated matches [226852] (4 species) not a true protein |
![]() | Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [226128] (1 PDB entry) |
![]() | Domain d2x9ha2: 2x9h A:25-68 [207158] Other proteins in same PDB: d2x9ha1 automated match to d1jwya1 complexed with ad9, ki9, mg |
PDB Entry: 2x9h (more details), 2.7 Å
SCOPe Domain Sequences for d2x9ha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x9ha2 b.34.3.0 (A:25-68) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} fkltvsdkryiwynpdpkerdsyecgeivsetsdsftfktvdgq
Timeline for d2x9ha2: