Lineage for d2x9ha1 (2x9h A:2-24,A:69-696)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111709Protein automated matches [190129] (6 species)
    not a true protein
  7. 2111785Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [226127] (1 PDB entry)
  8. 2111786Domain d2x9ha1: 2x9h A:2-24,A:69-696 [207157]
    Other proteins in same PDB: d2x9ha2
    automated match to d1jwya2
    complexed with ad9, ki9, mg

Details for d2x9ha1

PDB Entry: 2x9h (more details), 2.7 Å

PDB Description: crystal structure of myosin-2 motor domain in complex with adp-metavanadate and pentachlorocarbazole
PDB Compounds: (A:) myosin-2 heavy chain

SCOPe Domain Sequences for d2x9ha1:

Sequence, based on SEQRES records: (download)

>d2x9ha1 c.37.1.9 (A:2-24,A:69-696) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
dpihdrtsdyhkylkvkqgdsdlXdrqvkkddanqrnpikfdgvedmselsylnepavfh
nlrvrynqdliytysglflvavnpfkiipiytqemvdifkgrrrnevaphifaisdvayr
smlddrqnqsllitgesgagktentkkviqylasvagrnqangsgvleqqilqanpilea
fgnakttrnnnssrfgkfieiqfnsagfisgasiqsylleksrvvfqseternyhifyql
lagataeekkalhlagpesfnylnqsgcvdikgvsdseefkitrqamdivgfsqeeqmsi
fkiiagilhlgnikfekgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdl
vaqhlnvekssssrdalvkalygrlflwlvikinnvlcqerkayfigvldisgfeifkvn
sfeqlcinytneklqqffnhhmfkleqeeylkekinwtfidfgldsqatidlidgrqppg
ilalldeqsvfpnatdntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdw
leknkdplqqdlelcfkdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmat
lettnphfvrciipnnkqlpakledkvvldqlrcngvlegiritrkgfpnri

Sequence, based on observed residues (ATOM records): (download)

>d2x9ha1 c.37.1.9 (A:2-24,A:69-696) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
dpihdrtsdyhkylkvkqgdsdlXdrqvkkddanqrnpikfdgvedmselsylnepavfh
nlrvrynqdliytysglflvavnpfkiipiytqemvdifkgrrrnevaphifaisdvayr
smlddrqnqsllitgesgagktentkkviqylasvagrgsgvleqqilqanpileafgna
kttrnnnssrfgkfieiqfnsagfisgasiqsylleksrvvfqseternyhifyqllaga
taeekkalhlagpesfnylnqsgcvdikgvsdseefkitrqamdivgfsqeeqmsifkii
agilhlgnikfekgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqh
lnvekssssrdalvkalygrlflwlvikinnvlcqerkayfigvldisgfeifkvnsfeq
lcinytneklqqffnhhmfkleqeeylkekinwtfidfgldsqatidlidgrqppgilal
ldeqsvfpnatdntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwlekn
kdplqqdlelcfkdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatlett
nphfvrciipnnkqlpakledkvvldqlrcngvlegiritrkgfpnri

SCOPe Domain Coordinates for d2x9ha1:

Click to download the PDB-style file with coordinates for d2x9ha1.
(The format of our PDB-style files is described here.)

Timeline for d2x9ha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2x9ha2