Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
Protein Lactate dehydrogenase [56339] (18 species) |
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [56343] (17 PDB entries) |
Domain d2x8la2: 2x8l A:165-334 [207151] Other proteins in same PDB: d2x8la1 automated match to d1t2da2 complexed with gol |
PDB Entry: 2x8l (more details), 1.6 Å
SCOPe Domain Sequences for d2x8la2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x8la2 d.162.1.1 (A:165-334) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} gvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkryitvggiplqefinnklisd aeleaifdrtvntaleivnlhaspyvapaaaiiemaesylkdlkkvlicstllegqyghs difggtpvvlgangveqvielqlnseekakfdeaiaetkrmkalahhhhh
Timeline for d2x8la2: