Lineage for d2x8la1 (2x8l A:18-164)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2093044Family c.2.1.5: LDH N-terminal domain-like [51848] (9 protein domains)
  6. 2093083Protein Lactate dehydrogenase [51859] (18 species)
  7. 2093244Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51863] (14 PDB entries)
  8. 2093247Domain d2x8la1: 2x8l A:18-164 [207150]
    Other proteins in same PDB: d2x8la2, d2x8la3
    automated match to d1t2da1
    complexed with gol

Details for d2x8la1

PDB Entry: 2x8l (more details), 1.6 Å

PDB Description: plasmodium falciparum lactate dehydrogenase apo structure
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2x8la1:

Sequence, based on SEQRES records: (download)

>d2x8la1 c.2.1.5 (A:18-164) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
sgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnaf
iivvtnpvdvmvqllhqhsgvpknkiiglg

Sequence, based on observed residues (ATOM records): (download)

>d2x8la1 c.2.1.5 (A:18-164) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
sgsntyddlagadvvivtagftknrddllplnnkimieigghikkncpnafiivvtnpvd
vmvqllhqhsgvpknkiiglg

SCOPe Domain Coordinates for d2x8la1:

Click to download the PDB-style file with coordinates for d2x8la1.
(The format of our PDB-style files is described here.)

Timeline for d2x8la1: