SCOPe 2.07: Domain d2x88a3: 2x88 A:357-511

Lineage for d2x88a3 (2x88 A:357-511)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Spore coat protein A, CotA [89219] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [89220] (13 PDB entries)
   Uniprot P07788

8. Domain d2x88a3: 2x88 A:357-511 [207149]
   automated match to d1gska3
   complexed with cu, mpd, oxy

Details for d2x88a3

PDB Entry: 2x88, 1.8 Å

PDB Description: crystal structure of holocota

PDB Compounds: (A:) spore coat protein a

SCOPe Domain Sequences for d2x88a3:

Sequence; same for both SEQRES and ATOM records:

>d2x88a3 b.6.1.3 (A:357-511) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]}
sypsvqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptr
gthpihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlr
iaatfgpysgryvwhchilehedydmmrpmditdp

Timeline for d2x88a3:

• d2x88a3 first appeared in SCOPe 2.03
  
• d2x88a3 appears in SCOPe 2.06
  
• d2x88a3 appears in the current release, SCOPe 2.08