Lineage for d2x88a2 (2x88 A:183-356)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2771940Protein Spore coat protein A, CotA, middle domain [418913] (2 species)
  7. 2771941Species Bacillus subtilis [TaxId:1423] [419335] (13 PDB entries)
    Uniprot P07788
  8. 2771948Domain d2x88a2: 2x88 A:183-356 [207148]
    Other proteins in same PDB: d2x88a1, d2x88a3
    automated match to d1gska2
    complexed with cu, mpd, oxy

    has additional insertions and/or extensions that are not grouped together

Details for d2x88a2

PDB Entry: 2x88 (more details), 1.8 Å

PDB Description: crystal structure of holocota
PDB Compounds: (A:) spore coat protein a

SCOPe Domain Sequences for d2x88a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x88a2 b.6.1.3 (A:183-356) Spore coat protein A, CotA, middle domain {Bacillus subtilis [TaxId: 1423]}
klpsdeydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvwpy
leveprkyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaerydi
iidftayegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkyla

SCOPe Domain Coordinates for d2x88a2:

Click to download the PDB-style file with coordinates for d2x88a2.
(The format of our PDB-style files is described here.)

Timeline for d2x88a2: