| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
| Protein Spore coat protein A, CotA, middle domain [418913] (2 species) |
| Species Bacillus subtilis [TaxId:1423] [419335] (13 PDB entries) Uniprot P07788 |
| Domain d2x87a2: 2x87 A:183-356 [207145] Other proteins in same PDB: d2x87a1, d2x87a3 automated match to d1gska2 complexed with cu, edo, oh has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2x87 (more details), 2 Å
SCOPe Domain Sequences for d2x87a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x87a2 b.6.1.3 (A:183-356) Spore coat protein A, CotA, middle domain {Bacillus subtilis [TaxId: 1423]}
klpsdeydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvwpy
leveprkyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaerydi
iidftayegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkyla
Timeline for d2x87a2: