![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
![]() | Protein Spore coat protein A, CotA, N- and C-terminal domain [418912] (2 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [419334] (13 PDB entries) Uniprot P07788 |
![]() | Domain d2x87a1: 2x87 A:2-182 [207144] Other proteins in same PDB: d2x87a2 automated match to d1gska1 complexed with cu, edo, oh |
PDB Entry: 2x87 (more details), 2 Å
SCOPe Domain Sequences for d2x87a1:
Sequence, based on SEQRES records: (download)
>d2x87a1 b.6.1.3 (A:2-182) Spore coat protein A, CotA, N- and C-terminal domain {Bacillus subtilis [TaxId: 1423]} tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie vkrnenvyvkwmnnlpsthflpidhtihhsdsqheepevktvvhlhggvtpddsdgypea wfskdfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekr l
>d2x87a1 b.6.1.3 (A:2-182) Spore coat protein A, CotA, N- and C-terminal domain {Bacillus subtilis [TaxId: 1423]} tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie vkrnenvyvkwmnnlpsthflpidhtihheepevktvvhlhggvtpddsdgypeawfskd feqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekrl
Timeline for d2x87a1: