Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (35 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187294] (1319 PDB entries) |
Domain d2x7fc_: 2x7f C: [207141] automated match to d3efla_ complexed with 824, na |
PDB Entry: 2x7f (more details), 2.8 Å
SCOPe Domain Sequences for d2x7fc_:
Sequence, based on SEQRES records: (download)
>d2x7fc_ d.144.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlsalrdpagifelvelvgngtygqvykgrhvktgqlaaikvmdvtgdeeeeikqeinml kkyshhrniatyygafikknppgmddqlwlvmefcgagsvtdlikntkgntlkeewiayi creilrglshlhqhkvihrdikgqnvlltenaevklvdfgvsaqldrtvgrrntfigtpy wmapeviacdenpdatydfksdlwslgitaiemaegapplcdmhpmralfliprnpaprl kskkwskkfqsfiesclvknhsqrpateqlmkhpfirdqpnerqvriqlkdhidrtkkkr
>d2x7fc_ d.144.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlsalrdpagifelvelvgngtygqvykgrhvktgqlaaikvmdvtgdeeeeikqeinml kkyshhrniatyygafikknppgmddqlwlvmefcgagsvtdlikntkgntlkeewiayi creilrglshlhqhkvihrdikgqnvlltenaevklvdfgvsatpywmapeviacdepda tydfksdlwslgitaiemaegapplcdmhpmralfliprnpaprlkskkwskkfqsfies clvknhsqrpateqlmkhpfirdqpnerqvriqlkdhidrtkkkr
Timeline for d2x7fc_:
View in 3D Domains from other chains: (mouse over for more information) d2x7fa_, d2x7fb_, d2x7fd_, d2x7fe_ |