Lineage for d2x77a_ (2x77 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1366119Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1366120Protein automated matches [190123] (58 species)
    not a true protein
  7. 1366393Species Leishmania major [TaxId:5664] [225849] (1 PDB entry)
  8. 1366394Domain d2x77a_: 2x77 A: [207137]
    automated match to d1e0sa_
    complexed with gdp, mg

Details for d2x77a_

PDB Entry: 2x77 (more details), 2.1 Å

PDB Description: crystal structure of leishmania major adp ribosylation factor-like 1.
PDB Compounds: (A:) ADP-ribosylation factor

SCOPe Domain Sequences for d2x77a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x77a_ c.37.1.0 (A:) automated matches {Leishmania major [TaxId: 5664]}
wlaslkqtlgllpadrkirvlmlgldnagktsilyrlhlgdvvttvptvgvnletlqykn
isfevwdlggqtgvrpywrcyfsdtdaviyvvdstdrdrmgvakhelyalldedelrksl
llifankqdlpdaaseaeiaeqlgvssimnrtwtivksssktgdglvegmdwlverlreq
g

SCOPe Domain Coordinates for d2x77a_:

Click to download the PDB-style file with coordinates for d2x77a_.
(The format of our PDB-style files is described here.)

Timeline for d2x77a_: