Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (58 species) not a true protein |
Species Leishmania major [TaxId:5664] [225849] (1 PDB entry) |
Domain d2x77a_: 2x77 A: [207137] automated match to d1e0sa_ complexed with gdp, mg |
PDB Entry: 2x77 (more details), 2.1 Å
SCOPe Domain Sequences for d2x77a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x77a_ c.37.1.0 (A:) automated matches {Leishmania major [TaxId: 5664]} wlaslkqtlgllpadrkirvlmlgldnagktsilyrlhlgdvvttvptvgvnletlqykn isfevwdlggqtgvrpywrcyfsdtdaviyvvdstdrdrmgvakhelyalldedelrksl llifankqdlpdaaseaeiaeqlgvssimnrtwtivksssktgdglvegmdwlverlreq g
Timeline for d2x77a_: