![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
![]() | Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
![]() | Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [46766] (36 PDB entries) |
![]() | Domain d2x6oa1: 2x6o A:3-67 [207135] Other proteins in same PDB: d2x6oa2, d2x6oa3 automated match to d1bjza1 complexed with 2tc, cl |
PDB Entry: 2x6o (more details), 2.3 Å
SCOPe Domain Sequences for d2x6oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x6oa1 a.4.1.9 (A:3-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]} rlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveilar hhdys
Timeline for d2x6oa1: