Lineage for d2x5da_ (2x5d A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132823Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [225932] (6 PDB entries)
  8. 2132830Domain d2x5da_: 2x5d A: [207131]
    automated match to d3jtxb_
    complexed with plp, so4

Details for d2x5da_

PDB Entry: 2x5d (more details), 2.25 Å

PDB Description: Crystal Structure of a probable aminotransferase from Pseudomonas aeruginosa
PDB Compounds: (A:) probable aminotransferase

SCOPe Domain Sequences for d2x5da_:

Sequence, based on SEQRES records: (download)

>d2x5da_ c.67.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
vfnitaelkmaarrrgediidlsmgnpdgptpphiveklctvaqredthgystsrgiprl
rraishwyrdrydvqidpeseaivtigskeglahlmlatldhgdtilvpnpsypihiyga
viagaqvrsvplvpgidffnelerairesipkprmmilgfpsnptaqcveldffervval
akqydvmvvhdlayadivydgwkapsimqvpgakdiavefftlsksynmagwrigfmvgn
pelvsalariksyhdygtftplqvaaiaalegdqqcvrdiarqyqqrrdvlvkglreagw
mvenpkasmyvwakipepyahlgslefakkllqdakvsvspgigfgdygddhvrfalien
rdrlrqavrgikamfradgl

Sequence, based on observed residues (ATOM records): (download)

>d2x5da_ c.67.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
vfnitaelkmaarrrgediidlsmgnpdgptpphiveklctvatsrgiprlrraishwyr
drydvqidpeseaivtigskeglahlmlatldhgdtilvpnpsypihiygaviagaqvrs
vplvpgidffnelerairesipkprmmilgfpsnptaqcveldffervvalakqydvmvv
hdlayadivydgwkapsimqvpgakdiavefftlsksynmagwrigfmvgnpelvsalar
iksyhdygtftplqvaaiaalegdqqcvrdiarqyqqrrdvlvkglreagwmvenpkasm
yvwakipepyahlgslefakkllqdakvsvspgigfgdygddhvrfalienrdrlrqavr
gikamfradgl

SCOPe Domain Coordinates for d2x5da_:

Click to download the PDB-style file with coordinates for d2x5da_.
(The format of our PDB-style files is described here.)

Timeline for d2x5da_: