Lineage for d2x3yh_ (2x3y H:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908082Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2908083Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2908303Family c.80.1.0: automated matches [191405] (1 protein)
    not a true family
  6. 2908304Protein automated matches [190547] (18 species)
    not a true protein
  7. 2908310Species Burkholderia pseudomallei [TaxId:272560] [189351] (5 PDB entries)
  8. 2908334Domain d2x3yh_: 2x3y H: [207130]
    Other proteins in same PDB: d2x3ya2
    automated match to d3bjzc_
    complexed with zn

Details for d2x3yh_

PDB Entry: 2x3y (more details), 2.4 Å

PDB Description: crystal structure of gmha from burkholderia pseudomallei
PDB Compounds: (H:) Phosphoheptose isomerase

SCOPe Domain Sequences for d2x3yh_:

Sequence, based on SEQRES records: (download)

>d2x3yh_ c.80.1.0 (H:) automated matches {Burkholderia pseudomallei [TaxId: 272560]}
reltyitnsiaeaqrvmaamladerllatvrkvadaciasiaqggkvllagnggsaadaq
hiagefvsrfafdrpglpavalttdtsiltaigndygyeklfsrqvqalgnegdvligys
tsgkspnilaafreakakgmtcvgftgnrggemrelcdlllevpsadtpkiqeghlvlgh
ivcglvehsifg

Sequence, based on observed residues (ATOM records): (download)

>d2x3yh_ c.80.1.0 (H:) automated matches {Burkholderia pseudomallei [TaxId: 272560]}
reltyitnsiaeaqrvmaamladerllatvrkvadaciasiaqggkvllagnggsaadaq
hiagefvsrfafdrpglpavalttdtsiltaigndygyeklfsrqvqalgnegdvligys
tsgkspnilaafreakakgmtcvgftgnrgemrelcdlllevpsadtpkiqeghlvlghi
vcglvehsifg

SCOPe Domain Coordinates for d2x3yh_:

Click to download the PDB-style file with coordinates for d2x3yh_.
(The format of our PDB-style files is described here.)

Timeline for d2x3yh_: