Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.80: SIS domain [53696] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345 |
Superfamily c.80.1: SIS domain [53697] (4 families) |
Family c.80.1.0: automated matches [191405] (1 protein) not a true family |
Protein automated matches [190547] (18 species) not a true protein |
Species Burkholderia pseudomallei [TaxId:272560] [189351] (5 PDB entries) |
Domain d2x3yf_: 2x3y F: [207128] Other proteins in same PDB: d2x3ya2 automated match to d3bjzc_ complexed with zn |
PDB Entry: 2x3y (more details), 2.4 Å
SCOPe Domain Sequences for d2x3yf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x3yf_ c.80.1.0 (F:) automated matches {Burkholderia pseudomallei [TaxId: 272560]} reltyitnsiaeaqrvmaamladerllatvrkvadaciasiaqggkvllagnggsaadaq hiagefvsrfafdrpglpavalttdtsiltaigndygyeklfsrqvqalgnegdvligys tsgkspnilaafreakakgmtcvgftgnrggemrelcdlllevpsadtpkiqeghlvlgh ivcglvehsifg
Timeline for d2x3yf_: