Lineage for d2x3ye_ (2x3y E:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1875148Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 1875149Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 1875344Family c.80.1.0: automated matches [191405] (1 protein)
    not a true family
  6. 1875345Protein automated matches [190547] (14 species)
    not a true protein
  7. 1875351Species Burkholderia pseudomallei [TaxId:272560] [189351] (2 PDB entries)
  8. 1875360Domain d2x3ye_: 2x3y E: [207127]
    automated match to d3bjzc_
    complexed with zn

Details for d2x3ye_

PDB Entry: 2x3y (more details), 2.4 Å

PDB Description: crystal structure of gmha from burkholderia pseudomallei
PDB Compounds: (E:) Phosphoheptose isomerase

SCOPe Domain Sequences for d2x3ye_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x3ye_ c.80.1.0 (E:) automated matches {Burkholderia pseudomallei [TaxId: 272560]}
nreltyitnsiaeaqrvmaamladerllatvrkvadaciasiaqggkvllagnggsaada
qhiagefvsrfafdrpglpavalttdtsiltaigndygyeklfsrqvqalgnegdvligy
stsgkspnilaafreakakgmtcvgftgnrggemrelcdlllevpsadtpkiqeghlvlg
hivcglvehsifg

SCOPe Domain Coordinates for d2x3ye_:

Click to download the PDB-style file with coordinates for d2x3ye_.
(The format of our PDB-style files is described here.)

Timeline for d2x3ye_: