SCOPe 2.06: Domain d2x3ya1: 2x3y A:1-195

Lineage for d2x3ya1 (2x3y A:1-195)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.80: SIS domain [53696] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345

4. Superfamily c.80.1: SIS domain [53697] (4 families)

5. Family c.80.1.0: automated matches [191405] (1 protein)
   not a true family

6. Protein automated matches [190547] (15 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:272560] [189351] (5 PDB entries)

8. Domain d2x3ya1: 2x3y A:1-195 [207123]
   Other proteins in same PDB: d2x3ya2
   automated match to d3bjzc_
   complexed with zn

Details for d2x3ya1

PDB Entry: 2x3y, 2.4 Å

PDB Description: crystal structure of gmha from burkholderia pseudomallei

PDB Compounds: (A:) Phosphoheptose isomerase

SCOPe Domain Sequences for d2x3ya1:

Sequence; same for both SEQRES and ATOM records:

>d2x3ya1 c.80.1.0 (A:1-195) automated matches {Burkholderia pseudomallei [TaxId: 272560]}
menreltyitnsiaeaqrvmaamladerllatvrkvadaciasiaqggkvllagnggsaa
daqhiagefvsrfafdrpglpavalttdtsiltaigndygyeklfsrqvqalgnegdvli
gystsgkspnilaafreakakgmtcvgftgnrggemrelcdlllevpsadtpkiqeghlv
lghivcglvehsifg

Timeline for d2x3ya1:

• d2x3ya1 first appeared in SCOPe 2.03, called d2x3ya_
  
• d2x3ya1 was called d2x3ya_ in SCOPe 2.05
  
• d2x3ya1 appears in SCOPe 2.07
  
• d2x3ya1 appears in the current release, SCOPe 2.08