Lineage for d1qr1a1 (1qr1 A:182-275)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 364612Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 364613Species Human (Homo sapiens) [TaxId:9606] [88605] (65 PDB entries)
  8. 364667Domain d1qr1a1: 1qr1 A:182-275 [20712]
    Other proteins in same PDB: d1qr1a2, d1qr1b_, d1qr1d2, d1qr1e_

Details for d1qr1a1

PDB Entry: 1qr1 (more details), 2.4 Å

PDB Description: poor binding of a her-2/neu epitope (gp2) to hla-a2.1 is due to a lack of interactions in the center of the peptide

SCOP Domain Sequences for d1qr1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qr1a1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

SCOP Domain Coordinates for d1qr1a1:

Click to download the PDB-style file with coordinates for d1qr1a1.
(The format of our PDB-style files is described here.)

Timeline for d1qr1a1: