SCOP 1.59: Domain d1qr1a1: 1qr1 A:182-275

Lineage for d1qr1a1 (1qr1 A:182-275)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [48948] (28 PDB entries)

8. Domain d1qr1a1: 1qr1 A:182-275 [20712]
   Other proteins in same PDB: d1qr1a2, d1qr1d2

Details for d1qr1a1

PDB Entry: 1qr1, 2.4 Å

PDB Description: poor binding of a her-2/neu epitope (gp2) to hla-a2.1 is due to a lack of interactions in the center of the peptide

SCOP Domain Sequences for d1qr1a1:

Sequence; same for both SEQRES and ATOM records:

>d1qr1a1 b.1.1.2 (A:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2.1}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Timeline for d1qr1a1:

• d1qr1a1 first appeared (with stable ids) in SCOP 1.55
  
• d1qr1a1 appears in SCOP 1.57
  
• d1qr1a1 appears in SCOP 1.61
  
• d1qr1a1 appears in the current release, SCOPe 2.08