Lineage for d2x3tb4 (2x3t B:130-170)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3029894Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (3 families) (S)
  5. 3029895Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (7 proteins)
  6. 3029942Protein Wheat germ agglutinin (WGA) [57018] (1 species)
    one subunit consists of four homologous domains
  7. 3029943Species Wheat (Triticum aestivum), also known as Triticum vulgare [TaxId:4565] [57019] (13 PDB entries)
  8. 3030047Domain d2x3tb4: 2x3t B:130-170 [207112]
    automated match to d2cwga4
    complexed with dbb, gol, gyv

Details for d2x3tb4

PDB Entry: 2x3t (more details), 2.75 Å

PDB Description: glutaraldehyde-crosslinked wheat germ agglutinin isolectin 1 crystal soaked with a synthetic glycopeptide
PDB Compounds: (B:) agglutinin isolectin 1

SCOPe Domain Sequences for d2x3tb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x3tb4 g.3.1.1 (B:130-170) Wheat germ agglutinin (WGA) {Wheat (Triticum aestivum), also known as Triticum vulgare [TaxId: 4565]}
kpcgkdaggrvctnnyccskwgscgigpgycgagcqsggcd

SCOPe Domain Coordinates for d2x3tb4:

Click to download the PDB-style file with coordinates for d2x3tb4.
(The format of our PDB-style files is described here.)

Timeline for d2x3tb4: