SCOPe 2.08: Domain d2x24b1: 2x24 B:26-342

Lineage for d2x24b1 (2x24 B:26-342)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (71 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226064] (1 PDB entry)

8. Domain d2x24b1: 2x24 B:26-342 [207103]
   automated match to d1uyva1
   complexed with x24

Details for d2x24b1

PDB Entry: 2x24, 2.4 Å

PDB Description: bovine acc2 ct domain in complex with inhibitor

PDB Compounds: (B:) acetyl-coa carboxylase

SCOPe Domain Sequences for d2x24b1:

Sequence; same for both SEQRES and ATOM records:

>d2x24b1 c.14.1.0 (B:26-342) automated matches {Cow (Bos taurus) [TaxId: 9913]}
llqakrfqaqslgttyvydfpemfrqalfkmwpspdkypkdiltytelvldpqgqlvemn
rlpggnevgmvafkmtlktleypegrdiilisnditfrigsfgpgedllylraselarae
giprvylaansgariglaeeikhmfqvawvdpedphkgikylyltpqdytrisslnsvhc
khveedgesryvitdiigkeeglgvenlrgsgmiagetsqdydeivtismvscralgiga
ylvrlgqrviqvenshiiltgatalnkvlgrdvytsnnqlggvqimhhngvshvtvpddf
egvctilewlsympkdn

Timeline for d2x24b1:

• d2x24b1 first appeared in SCOPe 2.03
  
• d2x24b1 appears in SCOPe 2.07