Lineage for d2x24a1 (2x24 A:27-342)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1835239Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1835240Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1836183Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 1836184Protein automated matches [190246] (49 species)
    not a true protein
  7. 1836231Species Cow (Bos taurus) [TaxId:9913] [226064] (1 PDB entry)
  8. 1836232Domain d2x24a1: 2x24 A:27-342 [207101]
    automated match to d1uyva1
    complexed with x24

Details for d2x24a1

PDB Entry: 2x24 (more details), 2.4 Å

PDB Description: bovine acc2 ct domain in complex with inhibitor
PDB Compounds: (A:) acetyl-coa carboxylase

SCOPe Domain Sequences for d2x24a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x24a1 c.14.1.0 (A:27-342) automated matches {Cow (Bos taurus) [TaxId: 9913]}
lqakrfqaqslgttyvydfpemfrqalfkmwpspdkypkdiltytelvldpqgqlvemnr
lpggnevgmvafkmtlktleypegrdiilisnditfrigsfgpgedllylraselaraeg
iprvylaansgariglaeeikhmfqvawvdpedphkgikylyltpqdytrisslnsvhck
hveedgesryvitdiigkeeglgvenlrgsgmiagetsqdydeivtismvscralgigay
lvrlgqrviqvenshiiltgatalnkvlgrdvytsnnqlggvqimhhngvshvtvpddfe
gvctilewlsympkdn

SCOPe Domain Coordinates for d2x24a1:

Click to download the PDB-style file with coordinates for d2x24a1.
(The format of our PDB-style files is described here.)

Timeline for d2x24a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2x24a2