Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (49 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226064] (1 PDB entry) |
Domain d2x24a1: 2x24 A:27-342 [207101] automated match to d1uyva1 complexed with x24 |
PDB Entry: 2x24 (more details), 2.4 Å
SCOPe Domain Sequences for d2x24a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x24a1 c.14.1.0 (A:27-342) automated matches {Cow (Bos taurus) [TaxId: 9913]} lqakrfqaqslgttyvydfpemfrqalfkmwpspdkypkdiltytelvldpqgqlvemnr lpggnevgmvafkmtlktleypegrdiilisnditfrigsfgpgedllylraselaraeg iprvylaansgariglaeeikhmfqvawvdpedphkgikylyltpqdytrisslnsvhck hveedgesryvitdiigkeeglgvenlrgsgmiagetsqdydeivtismvscralgigay lvrlgqrviqvenshiiltgatalnkvlgrdvytsnnqlggvqimhhngvshvtvpddfe gvctilewlsympkdn
Timeline for d2x24a1: