| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) ![]() contains similar fold but lacks its catalytic centre |
| Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins) |
| Protein Hyaluronidase N-terminal domain [143619] (1 species) |
| Species Clostridium perfringens [TaxId:1502] [143620] (7 PDB entries) Uniprot Q8XL08 41-178 |
| Domain d2x0yb1: 2x0y B:40-178 [207094] Other proteins in same PDB: d2x0ya2, d2x0ya3, d2x0yb2, d2x0yb3 automated match to d2cbia3 complexed with x0t |
PDB Entry: 2x0y (more details), 2.25 Å
SCOPe Domain Sequences for d2x0yb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x0yb1 d.92.2.3 (B:40-178) Hyaluronidase N-terminal domain {Clostridium perfringens [TaxId: 1502]}
qvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendp
nsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtf
kqlvkesnipevnitdypt
Timeline for d2x0yb1: